Structure of PDB 6uz7 Chain AP

Receptor sequence

>6uz7AP (length=180) Species: 28985 (Kluyveromyces lactis)

RYGATSTNPAKSASARGSYLRVSYKNTRETAQAISGWNLQKAQKYLDQVL
DHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAASNA
EAKGLDATRLYVSHIQVNQAPKQRRRTFRAHGRINKYESSPSHIELVVTE
KEEAVEKASEKKVARLSSRQRGRLATQKRI

3D structure

• PDB: 6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.
• Chain: AP
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AP	R3 A17 R18 Y21 R23 S25 Y26 K27 N28 R30 Q34 K43 R62 S65 S66 I67 R69 A71 Q72 K74 E75 R82 W83 K86 N97 N101 H116 Q118 R126 R127 T129 F130 R131 A132 H133 I136 N137 K138 Y139 E140 S141 R167 S169 S170 R171 Q172 G174 R175 T178 I182	R1 A15 R16 Y19 R21 S23 Y24 K25 N26 R28 Q32 K41 R60 S63 S64 I65 R67 A69 Q70 K72 E73 R80 W81 K84 N95 N99 H114 Q116 R124 R125 T127 F128 R129 A130 H131 I134 N135 K136 Y137 E138 S139 R165 S167 S168 R169 Q170 G172 R173 T176 I180
BS02	rna	AP	Y4 G5 A6 R30 R61 N120 Q121	Y2 G3 A4 R28 R59 N118 Q119

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6uz7, PDBe:6uz7, PDBj:6uz7
• PDBsum: 6uz7
• PubMed: 31900355
• UniProt: Q6CXQ6