Structure of PDB 6sv4 Chain AP

Receptor sequence

>6sv4AP (length=105) Species: 4932 (Saccharomyces cerevisiae)

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF

3D structure

• PDB: 6sv4 RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.
• Chain: AP
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AP	V2 N3 P5 R8 K9 T10 K13 R18 K19 H20 A30 G31 S34 F36 A37 Q38 G39 R41 R42 R45 K46 G49 G52 Q53 K55 P56 V57 F58 H59 K60 A62 K63 K66 K67 R71 T79 R80 Q82 K86 K89 K97 K98 K100	V1 N2 P4 R7 K8 T9 K12 R17 K18 H19 A29 G30 S33 F35 A36 Q37 G38 R40 R41 R44 K45 G48 G51 Q52 K54 P55 V56 F57 H58 K59 A61 K62 K65 K66 R70 T78 R79 Q81 K85 K88 K96 K97 K99
BS02	rna	AP	L104 F106	L103 F105

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:0046898 response to cycloheximide

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6sv4, PDBe:6sv4, PDBj:6sv4
• PDBsum: 6sv4
• PubMed: 32203490
• UniProt: P0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)