Structure of PDB 4v8y Chain AP

Receptor sequence
>4v8yAP (length=124) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFM
KKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEI
RPEMLGHYLGEFSITYTPVRHGRA
3D structure
PDB4v8y Molecular architecture of a eukaryotic translational initiation complex.
ChainAP
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AP R18 P38 A39 R40 R42 R43 R44 R47 K59 R77 H79 R81 N82 Y97 N98 G99 K100 Y115 G117 T122 T124 V126 H128 R11 P31 A32 R33 R35 R36 R37 R40 K52 R70 H72 R74 N75 Y90 N91 G92 K93 Y108 G110 T115 T117 V119 H121
BS02 OHX AP L65 A67 E69 L58 A60 E62
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8y, PDBe:4v8y, PDBj:4v8y
PDBsum4v8y
PubMed24200810
UniProtQ01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]