Structure of PDB 4v8k Chain AP

Receptor sequence
>4v8kAP (length=40) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
TGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL
3D structure
PDB4v8k Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
ChainAP
Resolution3.006 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL AP W28 L31 V32 A35 H36 W22 L25 V26 A29 H30
BS02 BCL AP F29 V32 H36 W45 F23 V26 H30 W39
BS03 CRT AP F17 I20 F21 M25 F11 I14 F15 M19
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8k, PDBe:4v8k, PDBj:4v8k
PDBsum4v8k
PubMed24670637
UniProtD2Z0P1

[Back to BioLiP]