Structure of PDB 4v8a Chain AP

Receptor sequence

>4v8aAP (length=147) Species: 300852 (Thermus thermophilus HB8)

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGKDPRRFE
GGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVR
AGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLE

3D structure

• PDB: 4v8a The antibiotic thermorubin inhibits protein synthesis by binding to inter-subunit bridge b2a of the ribosome.
• Chain: AP
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AP	L3 S4 R7 P8 N9 A12 N13 K14 R16 K17 R18 V19 G20 R21 G22 P23 G24 G28 K29 T30 T32 R33 G34 H35 K36 G37 Q38 S40 R41 S42 K46 R50 F51 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 R65 G66 M67 Q70 V71 P72 G73 E74 I75 R77 Q81 N84 R90 K107 K108 K113 L115 G116 E117 S131 K132 S133	L3 S4 R7 P8 N9 A12 N13 K14 R16 K17 R18 V19 G20 R21 G22 P23 G24 G28 K29 T30 T32 R33 G34 H35 K36 G37 Q38 S40 R41 S42 K44 R48 F49 E50 G51 G52 R53 S54 M58 R59 L60 P61 K62 R63 G64 M65 Q68 V69 P70 G71 E72 I73 R75 Q79 N82 R88 K105 K106 K111 L113 G114 E115 S129 K130 S131

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8a, PDBe:4v8a, PDBj:4v8a
• PDBsum: 4v8a
• PubMed: 22240456
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)