Structure of PDB 4v83 Chain AP

Receptor sequence
>4v83AP (length=83) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE
3D structure
PDB4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
ChainAP
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AP M1 K3 R5 L6 G10 S11 K12 H13 H16 Y17 D23 R25 R26 K27 R28 K31 Y32 I33 K35 Y38 P41 K43 T44 V62 G63 Q65 T67 T69 R72 R75 R81 M1 K3 R5 L6 G10 S11 K12 H13 H16 Y17 D23 R25 R26 K27 R28 K31 Y32 I33 K35 Y38 P41 K43 T44 V62 G63 Q65 T67 T69 R72 R75 R81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum4v83
PubMed21245352
UniProtP62238|RS16_THET2 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]