Structure of PDB 4v72 Chain AP

Receptor sequence
>4v72AP (length=80) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNK
3D structure
PDB4v72 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainAP
Resolution13.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AP M1 V2 L6 R8 G10 K13 R14 F16 D23 A27 R28 N29 G30 R31 F32 R35 S44 Q63 R70 M1 V2 L6 R8 G10 K13 R14 F16 D23 A27 R28 N29 G30 R31 F32 R35 S44 Q63 R70
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003735 structural constituent of ribosome
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006259 DNA metabolic process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v72, PDBe:4v72, PDBj:4v72
PDBsum4v72
PubMed24186064
UniProtP0A7T3|RS16_ECOLI Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]