Structure of PDB 4v6o Chain AP

Receptor sequence

>4v6oAP (length=117) Species: 562 (Escherichia coli)

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPIKK

3D structure

• PDB: 4v6o Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: AP
• Resolution: 14.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AP	H11 K12 H13 T19 Y22 G23 V24 G25 K26 T27 R28 R69 S75 L79 Y85 R89 H90 R92 L94 P95 V96 R97 G98 Q99 R100 T101 K102 N104 R106 T107 R108 K109 P111 R112 K113 K117	H11 K12 H13 T19 Y22 G23 V24 G25 K26 T27 R28 R69 S75 L79 Y85 R89 H90 R92 L94 P95 V96 R97 G98 Q99 R100 T101 K102 N104 R106 T107 R108 K109 P111 R112 K113 K117
BS02	rna	AP	P114 I115 K116	P114 I115 K116

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
• PDBsum: 4v6o
• PubMed: 22467828
• UniProt: P0A7S9|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)