Structure of PDB 4v4z Chain AP

Receptor sequence

>4v4zAP (length=125) Species: 300852 (Thermus thermophilus HB8)

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKKAPRK

3D structure

• PDB: 4v4z Structural basis for messenger RNA movement on the ribosome.
• Chain: AP
• Resolution: 4.51 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AP	R14 Y23 G24 I25 K27 A28 R29 V74 N77 Y87 R88 H92 L96 R99 Q101 R102 T103 R104 T105 A107 R108 T109 R110 K111 R114 K115 T116 V117 K120 P124 R125 K126	R13 Y22 G23 I24 K26 A27 R28 V73 N76 Y86 R87 H91 L95 R98 Q100 R101 T102 R103 T104 A106 R107 T108 R109 K110 R113 K114 T115 V116 K119 P123 R124 K125
BS02	rna	AP	R93 R94	R92 R93

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4z, PDBe:4v4z, PDBj:4v4z
• PDBsum: 4v4z
• PubMed: 17051149
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)