Structure of PDB 4v4p Chain AP

Receptor sequence

>4v4pAP (length=138) Species: 300852 (Thermus thermophilus HB8)

SIKPTRREYISGIPGKGIAQFKMGNNTYPAQVENVVEKPVQIRHNALEAA
RNAANRFVQNSGKFRIRKFPFHVIREQDGDGMRAPFGKSVGTAARSHGAN
HDFIAWVNPDPAVEFAWRRAYMKVTPTVNIDSSPAGNA

3D structure

• PDB: 4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
• Chain: AP
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AP	S9 I10 K11 P12 T15 R16 R17 Y19 I20 I23 P24 Q30 F31 K32 A60 F71 F88 F90 R94 E95 M101 R102 A103 P104 K142 T146	S1 I2 K3 P4 T5 R6 R7 Y9 I10 I13 P14 Q20 F21 K22 A46 F57 F69 F71 R75 E76 M82 R83 A84 P85 K123 T127
BS02	rna	AP	D97 G98	D78 G79

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 03:37:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4p', asym_id = 'AP', title = 'Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4p', asym_id='AP', title='Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4p', asym_id = 'AP'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4p', asym_id='AP')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>