Structure of PDB 4v4g Chain AP

Receptor sequence
>4v4gAP (length=83) Species: 562 (Escherichia coli) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE
3D structure
PDB4v4g Structural basis for the control of translation initiation during stress.
ChainAP
Resolution11.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AP M1 K3 R5 F9 G10 S11 K12 N14 R18 R25 R26 K27 R28 D29 K31 Y58 V62 G63 T67 R72 M1 K3 R5 F9 G10 S11 K12 N14 R18 R25 R26 K27 R28 D29 K31 Y58 V62 G63 T67 R72
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 19:01:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4g', asym_id = 'AP', title = 'Structural basis for the control of translation initiation during stress.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4g', asym_id='AP', title='Structural basis for the control of translation initiation during stress.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4g', asym_id = 'AP'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4g', asym_id='AP')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>