Structure of PDB 3jbn Chain AP

Receptor sequence

>3jbnAP (length=204) Species: 36329 (Plasmodium falciparum 3D7)

GAYKYIQEIWKKKQSDAMHFLLRVRTWEYRQLPVVHRVSKPSRPDKARRL
GYKAIQGFVIYRVRVRRGDRKKRVKKGIVHGKPKHQGVHKQKSTRNLKSV
AEGKVGKSICGNLRVLNSYWVGQDAVYKYYEVILVDPNHNAVRNNPKINW
ICNPVHKHRELRGLTSAGKKYRGLRVKGHLSAKSRPSIRANWKRRQLIKL
RKCR

3D structure

• PDB: 3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
• Chain: AP
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AP	G2 Y4 K5 Q8 K12 K13 K14 Q15 R24 W28 R31 K41 R44 K47 R49 R50 L51 K54 A55 R65 R67 R68 G69 R71 K72 K73 R74 K76 K77 H81 G82 K83 P84 K85 H86 V89 H90 K91 K93 S94 T95 R96 N97 L98 K105 K108 G112 N113 W121 A126 Y128 K129 N139 N141 A142 N145 K148 W151 K158 H159 R160 L162 R163 S167 K170 K171 Y172 R173 L175 R176 K178 G179 H180 L181 K184 R186 S188 R190 W193 K194 R195 R196 K200 R202 K203 R205	G1 Y3 K4 Q7 K11 K12 K13 Q14 R23 W27 R30 K40 R43 K46 R48 R49 L50 K53 A54 R64 R66 R67 G68 R70 K71 K72 R73 K75 K76 H80 G81 K82 P83 K84 H85 V88 H89 K90 K92 S93 T94 R95 N96 L97 K104 K107 G111 N112 W120 A125 Y127 K128 N138 N140 A141 N144 K147 W150 K157 H158 R159 L161 R162 S166 K169 K170 Y171 R172 L174 R175 K177 G178 H179 L180 K183 R185 S187 R189 W192 K193 R194 R195 K199 R201 K202 R204
BS02	rna	AP	R38 Y62 I110 N113	R37 Y61 I109 N112

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
• PDBsum: 3jbn
• PubMed: 26432834
• UniProt: C0H4A6