Structure of PDB 8ove Chain AO

Receptor sequence

>8oveAO (length=149) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

SKIRRIGKKKGATLRDVHPWRWVKICSQHFKQEGKMMVPNCAEIVKTSHG
RERAPQNPDWYYIRCAAVLRAVYLRPGVGYGGLSKRFSSKKNRGSRPEIT
TRASKGLLHWCCKSLTKLELLEKCKGAGHRVTKLGRKVADTIAFKIALR

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AO	S10 K11 I12 R13 R14 I15 K17 K19 R30 K33 P48 N49 C50 T56 H58 R60 E61 R62 Q65 R73 R79 R84 Y89 G90 K94 R95 K99 G103 S104 R105 P106 T109 G115 H118 W119 H138 R139 K142 K146 D149 L157	S1 K2 I3 R4 R5 I6 K8 K10 R21 K24 P39 N40 C41 T47 H49 R51 E52 R53 Q56 R64 R70 R75 Y80 G81 K85 R86 K90 G94 S95 R96 P97 T100 G106 H109 W110 H129 R130 K133 K137 D140 L148

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum	8ove
PubMed	37985661
UniProt	Q583K7

[Back to BioLiP]