Structure of PDB 8ova Chain AO

Receptor sequence

>8ovaAO (length=154) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

ANSKIRRIGKKKGATLRDVHPWRWVKICSQHFKQEGKMMVPNCAEIVKTS
HGRERAPQNPDWYYIRCAAVLRAVYLRPGVGYGGLSKRFSSKKNRGSRPE
ITTRASKGLLHWCCKSLTKLELLEKCKGAGHRVTKLGRKVADTIAFKIAL
RKMG

3D structure

PDB

8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AO	S10 I12 R13 R14 I15 G16 K17 K19 G20 A21 H27 P28 W29 R30 K33 P48 N49 C50 T56 H58 R60 E61 R62 Q65 R73 R79 R84 G88 Y89 G90 G91 K94 R95 K99 G103 S104 R105 P106 T109 G115 H118 W119 K122 G135 H138 R139 K146 D149 R158 M160	S3 I5 R6 R7 I8 G9 K10 K12 G13 A14 H20 P21 W22 R23 K26 P41 N42 C43 T49 H51 R53 E54 R55 Q58 R66 R72 R77 G81 Y82 G83 G84 K87 R88 K92 G96 S97 R98 P99 T102 G108 H111 W112 K115 G128 H131 R132 K139 D142 R151 M153
BS02	MG	AO	N101 G103	N94 G96

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ova, PDBe:8ova, PDBj:8ova
PDBsum	8ova
PubMed	37985661
UniProt	Q583K7

[Back to BioLiP]