Structure of PDB 8evt Chain AO

Receptor sequence

>8evtAO (length=197) Species: 4932 (Saccharomyces cerevisiae)

VEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKL
KYHDFLRKATAFNKTRGPFHFRAPSRIFYKALRGMVSHKTARGKAALERL
KVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDV
VAKLEAKRKVSSAEYYAKKRAFTKKVASANATAAESDVAKQLAALGY

3D structure

• PDB: 8evt Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: AO
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AO	E4 P5 V6 K12 V16 G17 R18 S21 K25 K32 R37 S44 F48 R49 L52 H55 R59 K60 A61 T62 N65 K66 R68 G69 P70 F71 H72 F73 R74 K82 A83 R85 G86 M87 H90 K91 A93 R94 A97 R101 F105 I108 P109 P110 K114 K115 K116 R117 Q122 V126 R128 L129 K130 P131 R133 K134 V145 G146 K148 Y149 L156 K159 R160 K161 S164 Y167 Y168 K171 R172 K176	E2 P3 V4 K10 V14 G15 R16 S19 K23 K30 R35 S42 F46 R47 L50 H53 R57 K58 A59 T60 N63 K64 R66 G67 P68 F69 H70 F71 R72 K80 A81 R83 G84 M85 H88 K89 A91 R92 A95 R99 F103 I106 P107 P108 K112 K113 K114 R115 Q120 V124 R126 L127 K128 P129 R131 K132 V143 G144 K146 Y147 L154 K157 R158 K159 S162 Y165 Y166 K169 R170 K174
BS02	MG	AO	R68 G69	R66 G67

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8evt, PDBe:8evt, PDBj:8evt
• PDBsum: 8evt
• PubMed: 37595043
• UniProt: P26784|RL16A_YEAST Large ribosomal subunit protein uL13A (Gene Name=RPL16A)