Structure of PDB 7nql Chain AO

Receptor sequence

>7nqlAO (length=175) Species: 9823 (Sus scrofa) [Search protein sequence]

QDDPPPSMLLLDYQNVPGIHKVDDVVKRLLSLEMANQKEKLKIKKMQLMN
KVLENPEDTSSLEARIVALTVKIRNYEEHMQKHRKDKAHKRFLLMSIDQR
KKMLKNLRETNYAVFEKICKELGIEYTFPPPYHRKAHRRWVTKKALCTQV
FREVQKLKKQKRALRAAAVAAHKQG

3D structure

PDB

7nql Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AO	N100 Q101 T123 S124 R129 L133 K136 N139 Y140 H143 H147 D150 K151 A152 H153 K154 R155 F156 L158 M159 D162 Q163 K169 Y196 H197 R198 K199 H201 R202 R203 W204 K207 K208 C211 F215 K225 R226 R229	N36 Q37 T59 S60 R65 L69 K72 N75 Y76 H79 H83 D86 K87 A88 H89 K90 R91 F92 L94 M95 D98 Q99 K105 Y132 H133 R134 K135 H137 R138 R139 W140 K143 K144 C147 F151 K161 R162 R165

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0005761	mitochondrial ribosome
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nql, PDBe:7nql, PDBj:7nql
PDBsum	7nql
PubMed	33878294
UniProt	A0A287BMP0

[Back to BioLiP]