Structure of PDB 6yxy Chain AO

Receptor sequence
>6yxyAO (length=165) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
KLPAGKPANKSWFRHNLIIRRKASYRSRWGTGAEGYGTGVPFSDQVKLHC
VDNTNCKHVRLISKATAERFAHCRVFPAVAHRVSVQRFKVSRHRVKPGNI
YWVCLLSRRQTNTRMSGLRTNFDRNTCILMNDQRVPLGTRVMYCAGRHVN
HKYHLKAVVLANFFV
3D structure
PDB6yxy Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
ChainAO
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AO R40 R45 S46 W48 G49 T50 Y55 Q64 K66 R88 F89 H91 C92 H175 Y177 R21 R26 S27 W29 G30 T31 Y36 Q45 K47 R69 F70 H72 C73 H151 Y153
BS02 MG AO C69 D71 C75 C50 D52 C56
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 01:42:40 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6yxy', asym_id = 'AO', title = 'Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6yxy', asym_id='AO', title='Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6yxy', asym_id = 'AO'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6yxy', asym_id='AO')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>