Structure of PDB 6xir Chain AO

Receptor sequence
>6xirAO (length=134) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SDAVTIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEVYKAE
KDAVSVFGFRTQFGGGKSVGFGLVYNSVAEAKKFEPTYRLVRYGLAEKVE
KASRQQRKQKKNRDKKIFGTGKRLAKKVARRNAD
3D structure
PDB6xir Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.
ChainAO
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AO R8 T9 R10 K11 V12 N31 A33 N34 K37 G59 F60 R61 T62 F64 G65 G66 T88 Y89 R93 R105 Q106 R108 K109 Q110 N113 K117 F119 R124 R7 T8 R9 K10 V11 N30 A32 N33 K36 G58 F59 R60 T61 F63 G64 G65 T87 Y88 R92 R104 Q105 R107 K108 Q109 N112 K116 F118 R123
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xir, PDBe:6xir, PDBj:6xir
PDBsum6xir
PubMed32855298
UniProtP0CX31|RS24A_YEAST Small ribosomal subunit protein eS24A (Gene Name=RPS24A)

[Back to BioLiP]