Structure of PDB 6i7o Chain AO

Receptor sequence
>6i7oAO (length=52) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.
ChainAO
Resolution5.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AO K93 R97 K98 Y100 A101 R102 P104 R106 N109 R111 K112 R113 K114 G116 N119 R122 K124 K125 K128 K17 R21 K22 Y24 A25 R26 P28 R30 N33 R35 K36 R37 K38 G40 N43 R46 K48 K49 K52
BS02 ZN AO C96 C99 C110 C115 C20 C23 C34 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
PDBsum6i7o
PubMed30609991
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]