Structure of PDB 4v9j Chain AO

Receptor sequence
>4v9jAO (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v9j Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainAO
Resolution3.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AO P2 K8 Q9 F18 D21 T22 G23 Q28 L31 R38 H42 H46 K48 D49 H50 H51 R54 L57 M58 R65 L66 Y69 R72 P1 K7 Q8 F17 D20 T21 G22 Q27 L30 R37 H41 H45 K47 D48 H49 H50 R53 L56 M57 R64 L65 Y68 R71
BS02 rna AO S40 L43 K44 H53 G89 S39 L42 K43 H52 G88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9j, PDBe:4v9j, PDBj:4v9j
PDBsum4v9j
PubMed23812722
UniProtP62657|RS15_THET2 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]