Structure of PDB 4v6o Chain AO

Receptor sequence

>4v6oAO (length=123) Species: 562 (Escherichia coli) [Search protein sequence]

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA

3D structure

PDB

4v6o Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

14.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AO	A1 T2 N4 Q5 R8 K9 R11 A12 R13 K14 A16 K17 S18 N19 V20 A22 C26 P27 Q28 R35 Y37 P41 K42 K43 P44 N45 S46 R49 R53 T57 F60 Y65 G67 G68 E69 G70 R82 G83 R85 V86 K87 D88 L89 G91 R93 G99 A100 K107 D108 R109 K110 Q111 A112 R113 S114 K115 Y116 R120 K122 A123	A1 T2 N4 Q5 R8 K9 R11 A12 R13 K14 A16 K17 S18 N19 V20 A22 C26 P27 Q28 R35 Y37 P41 K42 K43 P44 N45 S46 R49 R53 T57 F60 Y65 G67 G68 E69 G70 R82 G83 R85 V86 K87 D88 L89 G91 R93 G99 A100 K107 D108 R109 K110 Q111 A112 R113 S114 K115 Y116 R120 K122 A123

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0034336	misfolded RNA binding

	Biological Process
GO:0000372	Group I intron splicing
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033120	positive regulation of RNA splicing
GO:0034337	RNA folding
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
PDBsum	4v6o
PubMed	22467828
UniProt	P0A7S3\|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)