Structure of PDB 4v68 Chain AO

Receptor sequence
>4v68AO (length=88) Species: 274 (Thermus thermophilus) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v68 GTPase activation of elongation factor EF-Tu by the ribosome during decoding
ChainAO
Resolution6.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AO P2 K5 K8 T22 G23 S24 Q28 R35 L39 H42 H46 K48 D49 H51 S52 R54 Q62 R68 Y69 P1 K4 K7 T21 G22 S23 Q27 R34 L38 H41 H45 K47 D48 H50 S51 R53 Q61 R67 Y68
BS02 rna AO H53 L56 L57 V60 R64 H52 L55 L56 V59 R63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v68, PDBe:4v68, PDBj:4v68
PDBsum4v68
PubMed19229291
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]