Structure of PDB 4v63 Chain AO

Receptor sequence
>4v63AO (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v63 Structural basis for translation termination on the 70S ribosome
ChainAO
Resolution3.207 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AO P2 K8 F18 D21 T22 G23 Q28 L31 R35 L39 H42 H46 K48 D49 H51 S52 R54 M59 Q62 R65 Y69 R72 P1 K7 F17 D20 T21 G22 Q27 L30 R34 L38 H41 H45 K47 D48 H50 S51 R53 M58 Q61 R64 Y68 R71
BS02 rna AO H53 L56 V60 H52 L55 V59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v63, PDBe:4v63, PDBj:4v63
PDBsum4v63
PubMed18596689
UniProtP62657|RS15_THET2 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]