Structure of PDB 4v5r Chain AO

Receptor sequence
>4v5rAO (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v5r How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
ChainAO
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AO P2 K5 K8 F18 T22 G23 S24 Q28 L31 R35 H42 H46 D49 H51 S52 R54 M59 R65 Y69 P1 K4 K7 F17 T21 G22 S23 Q27 L30 R34 H41 H45 D48 H50 S51 R53 M58 R64 Y68
BS02 rna AO K44 H53 L56 V60 R64 G89 K43 H52 L55 V59 R63 G88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5r, PDBe:4v5r, PDBj:4v5r
PDBsum4v5r
PubMed21378964
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]