Structure of PDB 4v4w Chain AO

Receptor sequence
>4v4wAO (length=86) Species: 562 (Escherichia coli) [Search protein sequence]
LSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHS
RRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLR
3D structure
PDB4v4w Elongation arrest by SecM via a cascade of ribosomal RNA rearrangements
ChainAO
Resolution15.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AO T21 G22 K47 H49 H50 R53 R57 K64 T20 G21 K46 H48 H49 R52 R56 K63
BS02 rna AO R52 R53 L55 L56 V59 R63 R51 R52 L54 L55 V58 R62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v4w, PDBe:4v4w, PDBj:4v4w
PDBsum4v4w
PubMed16713583
UniProtP0ADZ4|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]