Structure of PDB 4v4a Chain AO

Receptor sequence
>4v4aAO (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v4a X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli
ChainAO
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AO P2 K5 K8 I12 T22 G23 Q28 L31 R35 H42 H46 K48 D49 H51 S52 R54 G55 M58 R65 R68 Y69 P1 K4 K7 I11 T21 G22 Q27 L30 R34 H41 H45 K47 D48 H50 S51 R53 G54 M57 R64 R67 Y68
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Dec 3 13:28:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4a', asym_id = 'AO', title = 'X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4a', asym_id='AO', title='X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4a', asym_id = 'AO'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4a', asym_id='AO')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>