Structure of PDB 9cai Chain AN

Receptor sequence

>9caiAN (length=151) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

MGRMHNPGKGMAKSAIPYRRSVPSWQKMTAEEVQDQIVKMAKKGLRPSQI
GVILRDSHGVGQVRRLAGNKIFRILKSKGMAPELPEDLYHLVKKAVAIRK
HLERSRKDIDSKYRLILVESRIHRLARYYKTKRQLPPTWKYESGTAASLV
S

3D structure

PDB

9cai High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.

Chain

Resolution

2.59 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AN	M1 G2 R3 M4 H5 G8 K9 M11 A12 K13 S14 A15 P47 S48 G51 V52 R55 Q62 R64 K70 F72 R73 D87 H90 K94 I98 H101 K107 D108 I109 Y113 R114 I116 L117 S120 R121 R124 R127 Y128 K132	M1 G2 R3 M4 H5 G8 K9 M11 A12 K13 S14 A15 P47 S48 G51 V52 R55 Q62 R64 K70 F72 R73 D87 H90 K94 I98 H101 K107 D108 I109 Y113 R114 I116 L117 S120 R121 R124 R127 Y128 K132
BS02	rna	AN	H123 K140	H123 K140

External links

PDB	RCSB:9cai, PDBe:9cai, PDBj:9cai
PDBsum	9cai
PubMed	39209556
UniProt	P51404\|RS13_CAEEL Small ribosomal subunit protein uS15 (Gene Name=rps-13)

[Back to BioLiP]