Structure of PDB 8q5i Chain AN

Receptor sequence
>8q5iAN (length=52) Species: 5476 (Candida albicans) [Search protein sequence]
MIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
ChainAN
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AN K17 R21 Y24 R26 P28 R30 N33 R35 K36 R37 K38 G40 H41 N43 R46 K48 K49 K17 R21 Y24 R26 P28 R30 N33 R35 K36 R37 K38 G40 H41 N43 R46 K48 K49
BS02 ZN AN C20 C23 C34 C39 C20 C23 C34 C39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum8q5i
PubMed
UniProtA0A1D8PL68|RL40B_CANAL Large ribosomal subunit protein eL40 (Gene Name=RPL40B)

[Back to BioLiP]