Structure of PDB 7qi6 Chain AN

Receptor sequence
>7qi6AN (length=110) Species: 9606 (Homo sapiens) [Search protein sequence]
VRSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHD
ALQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGT
TYLESPLSSE
3D structure
PDB7qi6 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
ChainAN
Resolution2.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AN S7 H9 K21 M22 Q23 K24 T25 K27 Y38 N44 R46 K47 F50 R73 K75 H76 V77 K78 S4 H6 K18 M19 Q20 K21 T22 K24 Y35 N41 R43 K44 F47 R70 K72 H73 V74 K75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi6, PDBe:7qi6, PDBj:7qi6
PDBsum7qi6
PubMed38769321
UniProtQ9Y2R5|RT17_HUMAN Small ribosomal subunit protein uS17m (Gene Name=MRPS17)

[Back to BioLiP]