Structure of PDB 7q0r Chain AN

Receptor sequence

>7q0rAN (length=52) Species: 237561 (Candida albicans SC5314)

MIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK

3D structure

• PDB: 7q0r E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: AN
• Resolution: 2.67 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AN	R21 Y24 R26 P28 R30 N33 R35 K36 R37 K38 G40 H41 N43 R46 K48 K49	R21 Y24 R26 P28 R30 N33 R35 K36 R37 K38 G40 H41 N43 R46 K48 K49
BS02	ZN	AN	C20 C23 C34 C39	C20 C23 C34 C39

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q0r, PDBe:7q0r, PDBj:7q0r
• PDBsum: 7q0r
• PubMed: 35613268
• UniProt: A0A1D8PL68|RL40B_CANAL Large ribosomal subunit protein eL40 (Gene Name=RPL40B)