Structure of PDB 7og4 Chain AN

Receptor sequence
>7og4AN (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
RSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDA
LQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTT
YLESPLS
3D structure
PDB7og4 Structural basis of mitochondrial translation.
ChainAN
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AN R5 S7 K16 K21 M22 K24 T25 K27 R29 Y38 N44 R46 K47 F50 P72 R73 H76 K78 R1 S3 K12 K17 M18 K20 T21 K23 R25 Y34 N40 R42 K43 F46 P68 R69 H72 K74
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7og4, PDBe:7og4, PDBj:7og4
PDBsum7og4
PubMed32812867
UniProtQ9Y2R5|RT17_HUMAN Small ribosomal subunit protein uS17m (Gene Name=MRPS17)

[Back to BioLiP]