Structure of PDB 6xu8 Chain AN

Receptor sequence

>6xu8AN (length=150) Species: 7227 (Drosophila melanogaster)

GRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKIG
IILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRKH
LERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKYESSTASALVA

3D structure

• PDB: 6xu8 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
• Chain: AN
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AN	G2 R3 M4 H5 G8 K9 G10 I11 S12 Q13 S14 A15 P17 P47 S48 K49 G51 I52 R55 A61 Q62 R64 N69 K70 I71 L72 R73 K76 S77 M91 K94 H101 R106 K107 D108 K109 D110 K112 F113 R114 I116 S120 R121 R124 Y128	G1 R2 M3 H4 G7 K8 G9 I10 S11 Q12 S13 A14 P16 P46 S47 K48 G50 I51 R54 A60 Q61 R63 N68 K69 I70 L71 R72 K75 S76 M90 K93 H100 R105 K106 D107 K108 D109 K111 F112 R113 I115 S119 R120 R123 Y127

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0000228 nuclear chromosome
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xu8, PDBe:6xu8, PDBj:6xu8
• PDBsum: 6xu8
• PubMed: 34283226
• UniProt: Q03334|RS13_DROME Small ribosomal subunit protein uS15 (Gene Name=RpS13)