Structure of PDB 6xu6 Chain AN

Receptor sequence

>6xu6AN (length=150) Species: 7227 (Drosophila melanogaster)

GRMHAPGKGISQSALPYRRTVPSWLKLNADDVKEQIKKLGKKGLTPSKIG
IILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKAVAIRKH
LERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKYESSTASALVA

3D structure

• PDB: 6xu6 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
• Chain: AN
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AN	G2 R3 M4 H5 P7 G10 I11 S12 Q13 S14 A15 P17 R20 P47 S48 K49 I52 R55 A61 Q62 R64 K70 I71 L72 R73 K76 H90 M91 K94 I98 H101 K107 D108 D110 F113 R114 I116 S120 R124 R127 Y128 K132	G1 R2 M3 H4 P6 G9 I10 S11 Q12 S13 A14 P16 R19 P46 S47 K48 I51 R54 A60 Q61 R63 K69 I70 L71 R72 K75 H89 M90 K93 I97 H100 K106 D107 D109 F112 R113 I115 S119 R123 R126 Y127 K131
BS02	rna	AN	H123 K140	H122 K139

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0000228 nuclear chromosome
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xu6, PDBe:6xu6, PDBj:6xu6
• PDBsum: 6xu6
• PubMed: 34283226
• UniProt: Q03334|RS13_DROME Small ribosomal subunit protein uS15 (Gene Name=RpS13)