Structure of PDB 6nu3 Chain AN

Receptor sequence
>6nu3AN (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
RSSVHARWIVGKVIGTKMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDA
LQQCTVGDIVLLRALPVPRAKHVKHELAEIVFKVGKVIDPVTGKPCAGTT
YLESPLS
3D structure
PDB6nu3 Structural insights into unique features of the human mitochondrial ribosome recycling.
ChainAN
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AN R5 S6 S7 V8 H9 K21 Q23 T25 K27 Y38 N44 R46 T48 H52 P72 R73 A74 K75 H76 R1 S2 S3 V4 H5 K17 Q19 T21 K23 Y34 N40 R42 T44 H48 P68 R69 A70 K71 H72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu3, PDBe:6nu3, PDBj:6nu3
PDBsum6nu3
PubMed30962385
UniProtQ9Y2R5|RT17_HUMAN Small ribosomal subunit protein uS17m (Gene Name=MRPS17)

[Back to BioLiP]