Structure of PDB 5jc9 Chain AN

Receptor sequence
>5jc9AN (length=100) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB5jc9 Resistance mutations generate divergent antibiotic susceptibility profiles against translation inhibitors.
ChainAN
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AN A2 K3 Q4 S5 M6 A8 R9 R13 F21 R24 D33 L48 R53 S56 S58 R59 R61 N62 T67 R69 P70 H71 G72 F73 L74 R75 R81 I82 R85 K98 S100 W101 A1 K2 Q3 S4 M5 A7 R8 R12 F20 R23 D32 L47 R52 S55 S57 R58 R60 N61 T66 R68 P69 H70 G71 F72 L73 R74 R80 I81 R84 K97 S99 W100
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jc9, PDBe:5jc9, PDBj:5jc9
PDBsum5jc9
PubMed27382179
UniProtP0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)

[Back to BioLiP]