Structure of PDB 5j7y Chain AN

Receptor sequence

>5j7yAN (length=378) Species: 9940 (Ovis aries)

INIRKTHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFL
AMHYTPDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLFMHVGRG
LYYGSYTFLETWNIGVILLFATMATAFMGYVLPWGQMSFWGATVITNLLS
AIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFISPFIIAALAMVHLLFLH
ETGSNNPTGIPSDTDKIPFHPYYTIKDILGAILLILILMLLVLFTPDLLG
DPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILVL
VLMPLLHTSKQRSMMFRPISQCMFWILVADLLTLTWIGGQPVEHPYIIIG
QLASIMYILLIMVMMPVASIIENNLLKW

3D structure

• PDB: 5j7y The architecture of respiratory supercomplexes.
• Chain: AN
• Resolution: 6.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H201 S205 K227 D228 E271
• Catalytic site (residue number reindexed from 1): H200 S204 K226 D227 E270

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	AN	G48 A84 A87 Y131	G47 A83 A86 Y130

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:5j7y, PDBe:5j7y, PDBj:5j7y
• PDBsum: 5j7y
• PubMed: 27654913
• UniProt: P24959|CYB_SHEEP Cytochrome b (Gene Name=MT-CYB)