Structure of PDB 4v95 Chain AN

Receptor sequence

>4v95AN (length=59) Species: 300852 (Thermus thermophilus HB8)

RKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQ
LPGVRKASW

3D structure

• PDB: 4v95 Structural basis for the rescue of stalled ribosomes: structure of YaeJ bound to the ribosome.
• Chain: AN
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AN	R3 K4 A5 L6 E8 K9 F16 K17 V18 R19 Y21 T22 R29 A30 R31 S32 V33 R35 R41 I42 R45 E46 K58 S60 W61	R1 K2 A3 L4 E6 K7 F14 K15 V16 R17 Y19 T20 R27 A28 R29 S30 V31 R33 R39 I40 R43 E44 K56 S58 W59
BS02	ZN	AN	C24 R26 C27 C43	C22 R24 C25 C41

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Mar 11 03:19:12 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v95', asym_id = 'AN', title = 'Structural basis for the rescue of stalled ribosomes: structure of YaeJ bound to the ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v95', asym_id='AN', title='Structural basis for the rescue of stalled ribosomes: structure of YaeJ bound to the ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v95', asym_id = 'AN'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v95', asym_id='AN')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>