Structure of PDB 4v6r Chain AN

Receptor sequence

>4v6rAN (length=128) Species: 562 (Escherichia coli) [Search protein sequence]

AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSG
FRGSRKSTPFAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALN
AAGFRITNITDVTPIPHNGCRPPKKRRV

3D structure

PDB

4v6r Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

11.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AN	H21 H23 F26 N27 N28 I30 T32 G38 N39 A40 W43 T45 G47 R52 G53 S54 K56 K86 P114 P116 H117 N118 C120 R121 K124 K125 R126 R127 V128	H21 H23 F26 N27 N28 I30 T32 G38 N39 A40 W43 T45 G47 R52 G53 S54 K56 K86 P114 P116 H117 N118 C120 R121 K124 K125 R126 R127 V128
BS02	rna	AN	P4 I5 R6 K9 R10	P4 I5 R6 K9 R10

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6r, PDBe:4v6r, PDBj:4v6r
PDBsum	4v6r
PubMed	22467828
UniProt	P0A7R9\|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)