Structure of PDB 4v6m Chain AN

Receptor sequence

>4v6mAN (length=100) Species: 83333 (Escherichia coli K-12)

AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW

3D structure

• PDB: 4v6m Cryo-EM structure of the ribosome-SecYE complex in the membrane environment.
• Chain: AN
• Resolution: 7.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AN	A1 K2 Q3 S4 M5 R8 K11 R12 K18 R23 K27 D32 V33 N34 K46 Q48 R52 S55 S57 R58 R60 N61 R62 T66 R68 H70 G71 L73 R74 K75 R80 R84 K97 A98 S99 W100	A1 K2 Q3 S4 M5 R8 K11 R12 K18 R23 K27 D32 V33 N34 K46 Q48 R52 S55 S57 R58 R60 N61 R62 T66 R68 H70 G71 L73 R74 K75 R80 R84 K97 A98 S99 W100

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6m, PDBe:4v6m, PDBj:4v6m
• PDBsum: 4v6m
• PubMed: 21499241
• UniProt: P0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)