Structure of PDB 4v6i Chain AN

Receptor sequence
>4v6iAN (length=48) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFNKFR
3D structure
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
ChainAN
Resolution8.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AN S9 H10 R12 Y14 C24 S25 G29 L30 R32 N37 I38 C39 S1 H2 R4 Y6 C16 S17 G21 L22 R24 N29 I30 C31
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum4v6i
PubMed20980660
UniProtP41057|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)

[Back to BioLiP]