Structure of PDB 4v61 Chain AN

Receptor sequence
>4v61AN (length=99) Species: 3562 (Spinacia oleracea) [Search protein sequence]
ARKSLIQREKKRRNLEQKYHLIRRSSKQEIRKVTSLSDKWEIHGKLQSPP
RNSAPARLHRRCFLTGRPRANIRDFGLSGHILREMVHTCLLPGATRSSW
3D structure
PDB4v61 Cryo-EM study of the spinach chloroplast ribosome reveals the structural and functional roles of plastid-specific ribosomal proteins
ChainAN
Resolution9.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AN A2 R3 S5 L6 Q8 R9 E10 K12 R13 R24 R32 V34 P51 R52 A57 R58 H60 R61 T66 R68 P69 R70 N72 I73 R74 H81 R97 S99 W100 A1 R2 S4 L5 Q7 R8 E9 K11 R12 R23 R31 V33 P50 R51 A56 R57 H59 R60 T65 R67 P68 R69 N71 I72 R73 H80 R96 S98 W99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009507 chloroplast
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v61, PDBe:4v61, PDBj:4v61
PDBsum4v61
PubMed18042701
UniProtP06507|RR14_SPIOL Small ribosomal subunit protein uS14c (Gene Name=rps14)

[Back to BioLiP]