Structure of PDB 4v5s Chain AN

Receptor sequence
>4v5sAN (length=60) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW
3D structure
PDB4v5s How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
ChainAN
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AN A2 R3 K4 A5 E8 K9 K15 F16 K17 V18 R19 Y21 T22 C27 R29 R31 S32 Y34 R35 R41 I42 R45 E46 S60 W61 A1 R2 K3 A4 E7 K8 K14 F15 K16 V17 R18 Y20 T21 C26 R28 R30 S31 Y33 R34 R40 I41 R44 E45 S59 W60
BS02 ZN AN C24 C27 C40 C43 C23 C26 C39 C42
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Mar 10 04:25:29 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5s', asym_id = 'AN', title = 'How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5s', asym_id='AN', title='How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v5s', asym_id = 'AN'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v5s', asym_id='AN')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>