Structure of PDB 4v49 Chain AN

Receptor sequence

>4v49AN (length=60) Species: 562 (Escherichia coli)

ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKG
QLPGVRKASW

3D structure

• PDB: 4v49 X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli
• Chain: AN
• Resolution: 8.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AN	A2 K4 A5 L6 E8 K11 K15 F16 V18 R19 Y21 T22 C27 R29 R31 S32 Y34 R35 R41 I42 R45 E46 R57 K58 S60 W61	A1 K3 A4 L5 E7 K10 K14 F15 V17 R18 Y20 T21 C26 R28 R30 S31 Y33 R34 R40 I41 R44 E45 R56 K57 S59 W60

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:59:40 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v49', asym_id = 'AN', title = 'X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v49', asym_id='AN', title='X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v49', asym_id = 'AN'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v49', asym_id='AN')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>