Structure of PDB 3j9w Chain AN

Receptor sequence
>3j9wAN (length=60) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AKKSMIAKQQRTPKFKVQEYTRCERCGRPHSVIRKFKLCRICFRELAYKG
QIPGVKKASW
3D structure
PDB3j9w Structure of the Bacillus subtilis 70S ribosome reveals the basis for species-specific stalling.
ChainAN
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AN A2 S5 S32 V33 I34 R35 W61 A1 S4 S31 V32 I33 R34 W60
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j9w, PDBe:3j9w, PDBj:3j9w
PDBsum3j9w
PubMed25903689
UniProtP12878|RS14B_BACSU Small ribosomal subunit protein uS14B (Gene Name=rpsN1)

[Back to BioLiP]