Structure of PDB 8wln Chain AM |
>8wlnAM (length=164) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
DLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT EEHYSPNGDASKATLRSRQLNISEQVGAGPRSTQRNETSNYEVDRTIRHT KMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDK RGDTLNVVNSPFSA |
|
PDB | 8wln Cryo-EM structure of the MS ring with export apparatus and proximal rod within the motor-hook complex in the CCW state |
Chain | AM |
Resolution | 4.3 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
AM |
Q303 S357 Q359 |
Q75 S82 Q84 |
|
|
|