Structure of PDB 8q5i Chain AM

Receptor sequence

>8q5iAM (length=50) Species: 5476 (Candida albicans)

PSQKSFRTKQKLAKAQKQNRPLPQWIRLRTDNKIRYNAKRRHWRRTKLGI

3D structure

• PDB: 8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
• Chain: AM
• Resolution: 2.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AM	P2 S3 Q4 K5 K10 L13 Q17 I35 Y37 A39 R41 R42 H43 W44 R45 K48 L49	P1 S2 Q3 K4 K9 L12 Q16 I34 Y36 A38 R40 R41 H42 W43 R44 K47 L48
BS02	rna	AM	F7 R8 Q11 K15 K18 Q19 R21 L23 P24 W26 I27 L29 R30 T31 I35 K40	F6 R7 Q10 K14 K17 Q18 R20 L22 P23 W25 I26 L28 R29 T30 I34 K39

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
• PDBsum: 8q5i
• UniProt: Q96W55|RL39_CANAX Large ribosomal subunit protein eL39 (Gene Name=RPL39)