Structure of PDB 8oeq Chain AM

Receptor sequence
>8oeqAM (length=50) Species: 5476 (Candida albicans) [Search protein sequence]
PSQKSFRTKQKLAKAQKQNRPLPQWIRLRTDNKIRYNAKRRHWRRTKLGI
3D structure
PDB8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
ChainAM
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AM P2 S3 Q4 K5 K10 L13 P22 I35 R36 Y37 A39 R42 W44 R45 K48 L49 P1 S2 Q3 K4 K9 L12 P21 I34 R35 Y36 A38 R41 W43 R44 K47 L48
BS02 rna AM F7 R8 Q11 K12 K15 Q19 R21 L23 W26 L29 R30 T31 I35 N38 K40 F6 R7 Q10 K11 K14 Q18 R20 L22 W25 L28 R29 T30 I34 N37 K39
BS03 MG AM S3 K5 S2 K4
External links
PDB RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
PDBsum8oeq
PubMed
UniProtQ96W55|RL39_CANAX Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]