Structure of PDB 7qi6 Chain AM

Receptor sequence
>7qi6AM (length=119) Species: 9606 (Homo sapiens) [Search protein sequence]
KAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPN
SHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAER
LRRKRAREVLLASQKTDAE
3D structure
PDB7qi6 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
ChainAM
Resolution2.98 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AM K10 Y12 R13 G15 H16 R20 L21 T27 N28 Y32 H38 N39 K40 P42 R43 R46 F47 C79 G80 H82 S84 P86 R109 K1 Y3 R4 G6 H7 R11 L12 T18 N19 Y23 H29 N30 K31 P33 R34 R37 F38 C70 G71 H73 S75 P77 R100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi6, PDBe:7qi6, PDBj:7qi6
PDBsum7qi6
PubMed38769321
UniProtQ9Y3D3|RT16_HUMAN Small ribosomal subunit protein bS16m (Gene Name=MRPS16)

[Back to BioLiP]