Structure of PDB 7o0u Chain AM

Receptor sequence

>7o0uAM (length=49) Species: 1379270 (Gemmatimonas phototrophica)

MHRIWMGTDPHIIMSALGSFLVGAVLVMHIWAYGQFNWPATLKAKYATP

3D structure

• PDB: 7o0u 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
• Chain: AM
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	AM	H11 S15 G18	H11 S15 G18
BS02	BCL	AM	V22 H29 W38	V22 H29 W38
BS03	V7N	AM	H29 Y33	H29 Y33
BS04	V7N	AM	M14 W31	M14 W31
BS05	BCL	AM	M28 H29 W31 F36	M28 H29 W31 F36
BS06	V7N	AM	M1 R3	M1 R3

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 05:36:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7o0u', asym_id = 'AM', title = '2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7o0u', asym_id='AM', title='2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7o0u', asym_id = 'AM'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7o0u', asym_id='AM')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>