Structure of PDB 7lh5 Chain AM

Receptor sequence

>7lh5AM (length=116) Species: 300852 (Thermus thermophilus HB8)

AGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVV
RLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTR
TNARTRKGPRKTVAGK

3D structure

• PDB: 7lh5 Structural basis for plazomicin antibiotic action and resistance.
• Chain: AM
• Resolution: 3.27 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AM	R14 V17 Y21 Y23 G24 I25 G26 A28 R29 V74 N77 Y87 R88 R91 L96 P97 V98 R99 Q101 R102 T103 R104 T105 N106 A107 R108 T109 R110 K111 R114 K115 T116	R10 V13 Y17 Y19 G20 I21 G22 A24 R25 V70 N73 Y83 R84 R87 L92 P93 V94 R95 Q97 R98 T99 R100 T101 N102 A103 R104 T105 R106 K107 R110 K111 T112
BS02	MG	AM	G100 Q101	G96 Q97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7lh5, PDBe:7lh5, PDBj:7lh5
• PDBsum: 7lh5
• PubMed: 34117352
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)